A2226
HDAC9 Rabbit monoclonal antibody

Größe
Auf Anfrage
- SKU:
- A2226
- Zusätzliche Namen:
- HD7|HD7b|HD9|HDAC|HDAC7|HDAC7B|HDAC9|HDAC9B|HDAC9FL|HDRP|MITR
- Anwendung:
- ELISA, WB, IHC-P, IF, ICC
- Molekulargewicht:
- 150kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MHSMISSVDVKSEVPVGLEPISPLDLRTDLRMMMPVVDPVVREKQLQQELLLIQQQQQIQKQLLIAEFQKQHENLTRQHQAQLQEHIKELLAIKQQQELL
- Uniprot:
- Q9UKV0
- Synonyme:
- HD7;HD7b;HD9;HDAC;HDAC7;HDAC7B;HDAC9B;HDAC9FL;HDRP;histone deacetylase 4/5-related protein;histone deacetylase 7B;histone deacetylase 9;Histone deacetylase-related protein;MEF-2 interacting transcription repressor (MITR) protein;MEF2-interacting transcription repressor MITR;MITR
- Weitere Details:
- Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein encoded by this gene has sequence homology to members of the histone deacetylase family. This gene is orthologous to the Xenopus and mouse MITR genes. The MITR protein lacks the histone deacetylase catalytic domain. It represses MEF2 activity through recruitment of multicomponent corepressor complexes that include CtBP and HDACs. This encoded protein may play a role in hematopoiesis. Multiple alternatively spliced transcripts have been described for this gene but the full-length nature of some of them has not been determined.
- Versandbedingungen:
- Blue Ice








