A22238
SLC39A8 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A22238
- Zusätzliche Namen:
- BIGM103|CDG2N|LZT-Hs6|PP3105|SLC39A8|ZIP8
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 65kDa/130kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MAPGRAVAGLLLLAAAGLGGVAEGPGLAFSEDVLSVFGANLSLSAAQLQHLLEQMGAASRVGVPEPGQLHFNQCLTAEEIFSLHGFSNATQITSSKFSVI
- Uniprot:
- Q9C0K1
- Synonyme:
- BCG induced integral membrane protein BIGM103;BCG-induced integral membrane protein in monocyte clone 103 protein;BIGM103;CDG2N;LIV-1 subfamily of ZIP zinc transporter 6;LZT-Hs6;metal cation symporter ZIP8;PP3105;solute carrier family 39 (metal ion transporter), member 8;Solute carrier family 39 member 8;zinc transporter ZIP8;ZIP-8;ZIP8;Zrt- and Irt-like protein 8
- Weitere Details:
- This gene encodes a member of the SLC39 family of solute-carrier genes, which show structural characteristics of zinc transporters. The encoded protein is glycosylated and found in the plasma membrane and mitochondria, and functions in the cellular import of zinc at the onset of inflammation. It is also thought to be the primary transporter of the toxic cation cadmium, which is found in cigarette smoke. Multiple transcript variants encoding different isoforms have been found for this gene. Additional alternatively spliced transcript variants of this gene have been described, but their full-length nature is not known.
- Versandbedingungen:
- Blue Ice

