CYP3A4 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A22229
Zusätzliche Namen:: CP33|CP34|CYP3A|CYP3A3|CYP3A4|CYPIIIA3|CYPIIIA4|HLP|NF-25|P450C3|P450PCN1|VDDR3
Anwendung:: ELISA, WB, IF
Molekulargewicht:: 50kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: ALHRDPKYWTEPEKFLPERFSKKNKDNIDPYIYTPFGSGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLSLGGLLQPEKPVVLKVESRDGTVSGA
Uniprot:: P08684
Synonyme:: 1,4-cineole 2-exo-monooxygenase;1,8-cineole 2-exo-monooxygenase;Albendazole monooxygenase;albendazole monooxygenase (sulfoxide-forming);albendazole sulfoxidase;cholesterol 25-hydroxylase;CP33;CP34;CYP3A;CYP3A3;CYPIIIA3;CYPIIIA4;cytochrome P450 3A3;cytochrome P450 3A4;cytochrome P450 HLp;cytochrome P450 NF-25;cytochrome P450-PCN1;cytochrome P450, family 3, subfamily A, polypeptide 4;cytochrome P450, subfamily IIIA (niphedipine oxidase), polypeptide 3;cytochrome P450, subfamily IIIA (niphedipine oxidase), polypeptide 4;glucocorticoid-inducible P450;HLP;NF-25;nifedipine oxidase;P450-III, steroid inducible;P450C3;P450PCN1;quinine 3-monooxygenase;taurochenodeoxycholate 6-alpha-hydroxylase;VDDR3
Weitere Details:: This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases that catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and its expression is induced by glucocorticoids and some pharmacological agents. This enzyme is involved in the metabolism of approximately half the drugs in use today, including acetaminophen, codeine, cyclosporin A, diazepam, erythromycin, and chloroquine. The enzyme also metabolizes some steroids and carcinogens. This gene is part of a cluster of cytochrome P450 genes on chromosome 7q21.1. Previously another CYP3A gene, CYP3A3, was thought to exist; however, it is now thought that this sequence represents a transcript variant of CYP3A4. Alternatively spliced transcript variants encoding different isoforms have been identified.

Versandbedingungen:: Blue Ice