CPSF73 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A2222
Zusätzliche Namen:: CPSF-73|CPSF73|NEDMHS|NEDMHSN
Anwendung:: ELISA, WB, IP
Molekulargewicht:: 75kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: LEVQSNPKIRKGAVQKVSKKLEMHVYSKRLEIMLQDIFGEDCVSVKDDSILSVTVDGKTANLNLETRTVECEEGSEDDESLREMVELAAQRLYEALTPVH
Uniprot:: Q9UKF6
Synonyme:: cleavage and polyadenylation specific factor 3, 73kDa;Cleavage and polyadenylation specificity factor 73 kDa subunit;cleavage and polyadenylation specificity factor subunit 3;CPSF-73;CPSF73;mRNA 3'-end-processing endonuclease CPSF-73
Weitere Details:: This gene encodes a member of the metallo-beta-lactamase family. The encoded protein is a 73kDa subunit of the cleavage and polyadenylation specificity factor and functions as an endonuclease that recognizes the pre-mRNA 3'-cleavage site AAUAAA prior to polyadenylation. It also cleaves after the pre-mRNA sequence ACCCA during histone 3'-end pre-mRNA processing.