CHD3 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A2221
Zusätzliche Namen:: CHD3|Mi-2a|Mi2-ALPHA|SNIBCPS|ZFH
Anwendung:: ELISA, WB
Molekulargewicht:: 280kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: ERSILSRLASKGTEPHPTPAYPPGPYATPPGYGAAFSAAPVGALAAAGANYSQMPAGSFITAATNGPPVLVKKEKEMVGALVSDGLDRKEPRAGEVICIDD
Uniprot:: Q12873
Synonyme:: ATP-dependent helicase CHD3;CHD-3;chromodomain-helicase-DNA-binding protein 3;hZFH;mi-2 autoantigen 240 kDa protein;Mi-2a;Mi2-ALPHA;SNIBCPS;ZFH;zinc finger helicase;zinc-finger helicase (Snf2-like)
Weitere Details:: This gene encodes a member of the CHD family of proteins which are characterized by the presence of chromo (chromatin organization modifier) domains and SNF2-related helicase/ATPase domains. This protein is one of the components of a histone deacetylase complex referred to as the Mi-2/NuRD complex which participates in the remodeling of chromatin by deacetylating histones. Chromatin remodeling is essential for many processes including transcription. Autoantibodies against this protein are found in a subset of patients with dermatomyositis. Three alternatively spliced transcripts encoding different isoforms have been described.