Semaphorin 3A Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A22204
Zusätzliche Namen:: coll-1|COLL1|HH16|Hsema-I|Hsema-III|SEMA1|SEMAD|SEMAIII|SEMAL|Semaphorin 3A|SemD
Anwendung:: ELISA, WB
Molekulargewicht:: 89kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: ERIIYGVENSSTFLECSPKSQRALVYWQFQRRNEERKEEIRVDDHIIRTDQGLLLRSLQQKDSGNYLCHAVEHGFIQTLLKVTLEVIDTEHLEELLHKDDDGDGSKTKEMSNSMTPSQKVWYRDFMQLINHPNLNTMDEFCEQVWKRDRKQRRQRPGHTPGNSNKWKHLQENKKGRNRRTHEFERAPRSV
Uniprot:: Q14563
Synonyme:: coll-1;COLL1;collapsin 1;HH16;Hsema-I;Hsema-III;sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3A;SEMA1;SEMAD;SEMAIII;SEMAL;semaphorin D;semaphorin III;semaphorin L;semaphorin-3A;SemD
Weitere Details:: This gene is a member of the semaphorin family and encodes a protein with an Ig-like C2-type (immunoglobulin-like) domain, a PSI domain and a Sema domain. This secreted protein can function as either a chemorepulsive agent, inhibiting axonal outgrowth, or as a chemoattractive agent, stimulating the growth of apical dendrites. In both cases, the protein is vital for normal neuronal pattern development. Increased expression of this protein is associated with schizophrenia and is seen in a variety of human tumor cell lines. Also, aberrant release of this protein is associated with the progression of Alzheimer's disease.

Versandbedingungen:: Blue Ice