A2219
PER3 Rabbit monoclonal antibody

Größe
Auf Anfrage
- SKU:
- A2219
- Zusätzliche Namen:
- FASPS3|GIG13|PER3
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 132kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- GRRGAKDEALGEESGERWSPEFHLQRKLADSSHSEQQDRNRVSEELIMVVQEMKKYFPSERRNKPSTLDALNYALRCVHSVQANSEFFQIL
- Uniprot:
- P56645
- Synonyme:
- cell growth-inhibiting gene 13 protein;circadian clock protein PERIOD 3;FASPS3;GIG13;period circadian clock 3;period circadian protein 3;period circadian protein homolog 3
- Weitere Details:
- This gene is a member of the Period family of genes and is expressed in a circadian pattern in the suprachiasmatic nucleus, the primary circadian pacemaker in the mammalian brain. Genes in this family encode components of the circadian rhythms of locomotor activity, metabolism, and behavior. This gene is upregulated by CLOCK/ARNTL heterodimers but then represses this upregulation in a feedback loop using PER/CRY heterodimers to interact with CLOCK/ARNTL. Polymorphisms in this gene have been linked to sleep disorders. Multiple transcript variants encoding different isoforms have been found for this gene.
- Versandbedingungen:
- Blue Ice

