A22171
CD69 Rabbit monoclonal antibody

Größe
Auf Anfrage
- SKU:
- A22171
- Zusätzliche Namen:
- AIM|BL-AC/P26|CD69|CLEC2C|EA1|GP32/28|MLR-3
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 25-45kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- SVGQYNCPGQYTFSMPSDSHVSSCSEDWVGYQRKCYFISTVKRSWTSAQNACSEHGATLAVIDSEKDMNFLKRYAGREEHWVGLKKEPGHPWKWSNGKEFNNWFNVTGSDKCVFLKNTEVSSMECEKNLYWICNKPYK
- Uniprot:
- Q07108
- Synonyme:
- Activation inducer molecule;activation inducer molecule (AIM/CD69);AIM;BL-AC/P26;C-type lectin domain family 2 member C;C-type lectin domain family 2, member C;CD69 antigen (p60, early T-cell activation antigen);CLEC2C;EA1;early activation antigen CD69;early lymphocyte activation antigen;early T-cell activation antigen p60;GP32/28;leukocyte surface antigen Leu-23;MLR-3
- Weitere Details:
- This gene encodes a member of the calcium dependent lectin superfamily of type II transmembrane receptors. Expression of the encoded protein is induced upon activation of T lymphocytes, and may play a role in proliferation. Furthermore, the protein may act to transmit signals in natural killer cells and platelets.
- Versandbedingungen:
- Blue Ice



