HDAC6 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A22169
Zusätzliche Namen:: CPBHM|HD6|HDAC6|JM21|PPP1R90
Anwendung:: ELISA, WB
Molekulargewicht:: 160kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: NGAAVVRPPGHHAEQDAACGFCFFNSVAVAARHAQTISGHALRILIVDWDVHHGNGTQHMFEDDPSVLYVSLHRYDHGTFFPMGDEGASSQIGRAAGTGFT
Uniprot:: Q9UBN7
Synonyme:: CPBHM;HD6;histone deacetylase 6;JM21;PPP1R90;protein phosphatase 1, regulatory subunit 90;tubulin-lysine deacetylase HDAC6
Weitere Details:: Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein encoded by this gene belongs to class II of the histone deacetylase/acuc/apha family. It contains an internal duplication of two catalytic domains which appear to function independently of each other. This protein possesses histone deacetylase activity and represses transcription.