A22163
OGDH Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A22163
- Zusätzliche Namen:
- AKGDH|E1k|E1o|KGD1|OGDC|OGDH|OGDH-E1|OGDH2|OGDHD
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 116 kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- RSSFDEMLPGTHFQRVIPEDGPAAQNPENVKRLLFCTGKVYYDLTRERKARDMVGQVAITRIEQLSPFPFDLLLKEVQKYPNAELAWCQEEHKNQGYYDYVKPRLRTTISRAKPVWYAGRDPAAAPATGNKKTHLTELQRLLDTAFDLDVFKNFS
- Uniprot:
- Q02218
- Synonyme:
- 2-oxoglutarate dehydrogenase complex component E1;2-oxoglutarate dehydrogenase, mitochondrial;AKGDH;Alpha-ketoglutarate dehydrogenase;E1k;KGD1;OGDC;OGDC-E1;OGDH2;oxoglutarate (alpha-ketoglutarate) dehydrogenase (lipoamide);oxoglutarate decarboxylase;oxoglutarate dehydrogenase (succinyl-transferring);testicular tissue protein Li 131
- Weitere Details:
- This gene encodes one subunit of the 2-oxoglutarate dehydrogenase complex. This complex catalyzes the overall conversion of 2-oxoglutarate (alpha-ketoglutarate) to succinyl-CoA and CO(2) during the Krebs cycle. The protein is located in the mitochondrial matrix and uses thiamine pyrophosphate as a cofactor. A congenital deficiency in 2-oxoglutarate dehydrogenase activity is believed to lead to hypotonia, metabolic acidosis, and hyperlactatemia. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
- Versandbedingungen:
- Blue Ice