ABflo[R] 647 Rabbit anti-Human/Monkey CD20 monoclonal antibody

Größe

Auf Anfrage

SKU:: A22153
Zusätzliche Namen:: B1|Bp35|CD20|CVID5|FMC7|LEU-16|S7
Anwendung:: Flow Cytometry
Molekulargewicht:: Refer to figures
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: 2-8[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: LLAATEKNSRKCLVKGKMIMNSLSLFAAISGMILSIMDILNIKISHFLKMESLNFIRAHTPYINIYNCEPANPSEKNSPSTQYCYSIQSLFLGILSVMLIF
Uniprot:: P12314
Synonyme:: B-lymphocyte antigen CD20;B-lymphocyte cell-surface antigen B1;B1;Bp35;CD20;CD20 antigen;CD20 receptor;CD64;CD64A;CVID5;Fc fragment of IgG, high affinity Ia, receptor (CD64);Fc fragment of IgG, high affinity Ia, receptor for (CD64);Fc gamma receptor Ia;Fc-gamma receptor I A1;Fc-gamma RI;fc-gamma RIA;FcgammaRI;fcgammaRIa;FCRI;FMC7;high affinity immunoglobulin gamma Fc receptor I;IGFR1;IgG Fc receptor I;LEU-16;leukocyte surface antigen Leu-16;membrane-spanning 4-domains, subfamily A, member 1;S7
Weitere Details:: This gene encodes a member of the membrane-spanning 4A gene family. Members of this nascent protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues. This gene encodes a B-lymphocyte surface molecule which plays a role in the development and differentiation of B-cells into plasma cells. This family member is localized to 11q12, among a cluster of family members. Alternative splicing of this gene results in two transcript variants which encode the same protein.

Versandbedingungen:: Blue Ice