A22150
P4HA2 Rabbit monoclonal antibody

Größe
Auf Anfrage
- SKU:
- A22150
- Zusätzliche Namen:
- lncRNA-PE|MYP25|P4HA2
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 61 kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- GTKYQAMLSVDDCFGMGRSAYNEGDYYHTVLWMEQVLKQLDAGEEATTTKSQVLDYLSYAVFQLGDLHRALELTRRLLSLDPSHERAGGNLRYFEQLLEEEREKTLTNQTEAELATPEGIYERPVDYLPERDVYESLCRGEGVKLTPRRQKRLFCRYHHGNRAPQLLIAPFKEEDEW
- Uniprot:
- O15460
- Synonyme:
- 4-PH alpha 2;C-P4Halpha(II);collagen prolyl 4-hydroxylase alpha(II);MYP25;procollagen-proline, 2-oxoglutarate 4-dioxygenase (proline 4-hydroxylase), alpha polypeptide II;procollagen-proline,2-oxoglutarate-4-dioxygenase subunit alpha-2;prolyl 4-hydroxylase subunit alpha-2;prolyl 4-hydroxylase, alpha polypeptide II
- Weitere Details:
- This gene encodes a component of prolyl 4-hydroxylase, a key enzyme in collagen synthesis composed of two identical alpha subunits and two beta subunits. The encoded protein is one of several different types of alpha subunits and provides the major part of the catalytic site of the active enzyme. In collagen and related proteins, prolyl 4-hydroxylase catalyzes the formation of 4-hydroxyproline that is essential to the proper three-dimensional folding of newly synthesized procollagen chains. Alternatively spliced transcript variants encoding different isoforms have been described.
- Versandbedingungen:
- Blue Ice

