NANOG Rabbit polyclonal antibody

Größe

£152.00

SKU:: A22115
Zusätzliche Namen:: 2410002E02Rik|ecat4|ENK|NANOG|Stm1
Anwendung:: ELISA, WB
Molekulargewicht:: 29-42kDa
Spezies-Reaktivität:: Mouse
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: LKTSNGLIQKGSAPVEYPSIHCSYPQGYLVNASGSLSMWGSQTWTNPTWSSQTWTNPTWNNQTWTNPTWSSQAWTAQSWNGQPWNAAPLHNFGEDFLQPYVQLQQNFSASDLEVNLEATRESHAHFSTPQALELFLNYSVTPPGEI
Uniprot:: Q80Z64
Synonyme:: 2410002E02Rik;early embryo specific expression NK family;early embryo specific expression NK-type homeobox protein;ecat;ecat4;EN;ENK;ES cell-associated protein 4;homeobox protein NANOG;homeobox transcription factor Nanog
Weitere Details:: The protein encoded by this gene is a DNA binding homeobox transcription factor involved in embryonic stem (ES) cell proliferation, renewal, and pluripotency. The encoded protein can block ES cell differentiation and can also autorepress its own expression in differentiating cells. Several transcript variants encoding different isoforms have been found for this gene.