COP1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A22106
Zusätzliche Namen:: CFAP78|COP1|FAP78|RFWD2|RNF200
Anwendung:: ELISA, WB
Molekulargewicht:: 102kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: YYDLRNTKQPIMVFKGHRKAVSYAKFVSGEEIVSASTDSQLKLWNVGKPYCLRSFKGHINEKNFVGLASNGDYIACGSENNSLYLYYKGLSKTLLTFKFDTVKSVLDKDRKEDDTNEFVSAVCWRALPDGESNVLIAANSQGTIKVLELV
Uniprot:: Q8NHY2
Synonyme:: CFAP78;constitutive photomorphogenesis protein 1 homolog;constitutive photomorphogenic protein 1;E3 ubiquitin-protein ligase COP1;E3 ubiquitin-protein ligase RFWD2;FAP78;putative ubiquitin ligase COP1;RFWD2;ring finger and WD repeat domain 2, E3 ubiquitin protein ligase;RING finger and WD repeat domain protein 2;RING finger protein 200;RING-type E3 ubiquitin transferase RFWD2;RNF200
Weitere Details:: Enables ubiquitin protein ligase activity. Involved in positive regulation of proteasomal ubiquitin-dependent protein catabolic process; proteasome-mediated ubiquitin-dependent protein catabolic process; and response to ionizing radiation. Part of Cul4A-RING E3 ubiquitin ligase complex.