A22097
GDF15 Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A22097
- Zusätzliche Namen:
- GDF-15|GDF15|MIC-1|MIC1|NAG-1|PDF|PLAB|PTGFB
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 35kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- HLHLRISRAALPEGLPEASRLHRALFRLSPTASRSWDVTRPLRRQLSLARPQAPALHLRLSPPPSQSDQLLAESSSARPQLELHLRPQAARGRRRARARNG
- Uniprot:
- Q99988
- Synonyme:
- GDF-15;growth/differentiation factor 15;macrophage inhibitory cytokine 1;MIC-1;MIC1;NAG-1;non-steroidal anti-inflammatory drug-activated gene-1;NRG-1;NSAID (nonsteroidal anti-inflammatory drug)-activated protein 1;NSAID-activated gene 1 protein;NSAID-regulated gene 1 protein;PDF;PLAB;placental bone morphogenetic protein;placental TGF-beta;prostate differentiation factor;PTGF-beta;PTGFB
- Weitere Details:
- This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer. The protein is expressed in a broad range of cell types, acts as a pleiotropic cytokine and is involved in the stress response program of cells after cellular injury. Increased protein levels are associated with disease states such as tissue hypoxia, inflammation, acute injury and oxidative stress.
- Versandbedingungen:
- Blue Ice