PDHA1 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A22084
Zusätzliche Namen:: E1alpha|PDHA|PDHA1|PDHAD|PDHCE1A|PHE1A
Anwendung:: ELISA, WB
Molekulargewicht:: 43kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: IPGLRVDGMDILCVREATRFAAAYCRSGKGPILMELQTYRYHGHSMSDPGVSYRTREEIQEVRSKSDPIMLLKDRMVNSNLASVEELKEIDVEVRKEIED
Uniprot:: P08559
Synonyme:: PDHA;PDHAD;PDHCE1A;PDHE1-A type I;PHE1A;pyruvate dehydrogenase (lipoamide) alpha 1;pyruvate dehydrogenase alpha 1;pyruvate dehydrogenase complex, E1-alpha polypeptide 1;pyruvate dehydrogenase E1 alpha 1 subunit;pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial
Weitere Details:: The pyruvate dehydrogenase (PDH) complex is a nuclear-encoded mitochondrial multienzyme complex that catalyzes the overall conversion of pyruvate to acetyl-CoA and CO(2), and provides the primary link between glycolysis and the tricarboxylic acid (TCA) cycle. The PDH complex is composed of multiple copies of three enzymatic components: pyruvate dehydrogenase (E1), dihydrolipoamide acetyltransferase (E2) and lipoamide dehydrogenase (E3). The E1 enzyme is a heterotetramer of two alpha and two beta subunits. This gene encodes the E1 alpha 1 subunit containing the E1 active site, and plays a key role in the function of the PDH complex. Mutations in this gene are associated with pyruvate dehydrogenase E1-alpha deficiency and X-linked Leigh syndrome. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Versandbedingungen:: Blue Ice