CD24 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A2207
Zusätzliche Namen:: CD24|CD24A
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 30-45 kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MGRAMVARLGLGLLLLALLLPTQIYSSETTTGTSSNSSQSTSNSGLAPNPTNATTKAAGGALQSTASLFVVSLSLLHLYS
Uniprot:: P25063
Synonyme:: CD24 antigen (small cell lung carcinoma cluster 4 antigen);CD24A;signal transducer CD24;Small cell lung carcinoma cluster 4 antigen
Weitere Details:: This gene encodes a sialoglycoprotein that is expressed on mature granulocytes and B cells and modulates growth and differentiation signals to these cells. The precursor protein is cleaved to a short 32 amino acid mature peptide which is anchored via a glycosyl phosphatidylinositol (GPI) link to the cell surface. This gene was missing from previous genome assemblies, but is properly located on chromosome 6. Non-transcribed pseudogenes have been designated on chromosomes 1, 15, 20, and Y. Alternative splicing results in multiple transcript variants.