ABflo[R] 488 Rabbit anti-Human Cytokeratin 19/KRT19 monoclonal antibody

Größe

£243.00

War £324.00

SKU:: A22065
Zusätzliche Namen:: CK19|K19|K1CS
Anwendung:: Flow Cytometry
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: 2-8[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: RTLQGLEIELQSQLSMKAALEDTLAETEARFGAQLAHIQALISGIEAQLGDVRADSERQNQEYQRLMDIKSRLEQEIATYRSLLEGQEDHYNNLSASKVL
Uniprot:: P08727
Synonyme:: 40-kDa keratin intermediate filament;CK-19;CK19;cytokeratin 19;Cytokeratin-19;K19;K1CS;keratin 19, type I;Keratin-19;keratin, type I cytoskeletal 19;keratin, type I, 40-kd
Weitere Details:: The protein encoded by this gene is a member of the keratin family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. The type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains. Unlike its related family members, this smallest known acidic cytokeratin is not paired with a basic cytokeratin in epithelial cells. It is specifically expressed in the periderm, the transiently superficial layer that envelopes the developing epidermis. The type I cytokeratins are clustered in a region of chromosome 17q12-q21.