A22057
PTPIP51/RMDN3 Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A22057
- Zusätzliche Namen:
- FAM82A2|FAM82C|ptpip51|PTPIP51/RMDN3|RMD-3|RMD3
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 52kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- VSCETVKMGRKDSLDLEEEAASGASSALEAGGSSGLEDVLPLLQQADELHRGDEQGKREGFQLLLNNKLVYGSRQDFLWRLARAYSDMCELTEEVSEKKSY
- Uniprot:
- Q96TC7
- Synonyme:
- cerebral protein 10;FAM82A2;FAM82C;family with sequence similarity 82, member A2;family with sequence similarity 82, member C;microtubule-associated protein;Protein FAM82A2;Protein FAM82C;protein tyrosine phosphatase-interacting protein 51;ptpip51;regulator of microtubule dynamics protein 3;RMD-3;RMD3;TCPTP-interacting protein 51
- Weitere Details:
- Enables microtubule binding activity. Involved in cellular calcium ion homeostasis. Located in several cellular components, including intercellular bridge; mitochondrial outer membrane; and spindle.
- Versandbedingungen:
- Blue Ice