A22052
SOX11 Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A22052
- Zusätzliche Namen:
- CSS9|IDDMOH|MRD27|SOX11
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 60kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MVQQAESLEAESNLPREALDTEEGEFMACSPVALDESDPDWCKTASGHIKRPMNAFMVWSKIERRKIMEQSPDMHNAEISKRLGKRWKMLKDSEKIPFIR
- Uniprot:
- P35716
- Synonyme:
- CSS9;MRD27;SRY (sex-determining region Y)-box 11;SRY-box 11;SRY-related HMG-box gene 11;transcription factor SOX-11
- Weitere Details:
- This intronless gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. The protein may function in the developing nervous system and play a role in tumorigenesis.
- Versandbedingungen:
- Blue Ice