PBEF/Visfatin/NAMPT Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A22044
Zusätzliche Namen:: 1110035O14Rik|PBEF|PBEF/Visfatin/NAMPT|PBEF1|VF|VISFATIN
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 52kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: VSRSTQAPLIIRPDSGNPLDTVLKVLEILGKKFPVTENSKGYKLLPPYLRVIQGDGVDINTLQEIVEGMKQKMWSIENIAFGSGGGLLQKLTRDLLNCSFK
Uniprot:: P43490
Synonyme:: 1110035O14Rik;NAmPRTase;nicotinamide phosphoribosyltransferase;PBEF;PBEF1;pre-B cell-enhancing factor;pre-B-cell colony-enhancing factor 1;VF;VISFATIN
Weitere Details:: This gene encodes a protein that catalyzes the condensation of nicotinamide with 5-phosphoribosyl-1-pyrophosphate to yield nicotinamide mononucleotide, one step in the biosynthesis of nicotinamide adenine dinucleotide. The protein belongs to the nicotinic acid phosphoribosyltransferase (NAPRTase) family and is thought to be involved in many important biological processes, including metabolism, stress response and aging. This gene has a pseudogene on chromosome 10.