A22031
INTS11 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A22031
- Zusätzliche Namen:
- CPSF3L|CPSF73L|INT11|INTS11|RC-68|RC68
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 68kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- GQSLQIFRKWAGNEKNMVIMPGYCVQGTVGHKILSGQRKLEMEGRQVLEVKMQVEYMSFSAHADAKGIMQLVGQAEPESVLLVHGEAKKMEFLKQKIEQELRVNCYMPANGETVTLPTSPSIPVGISLGLLKREMAQGLLPEAKKPRLLHGTLIMKDSNFRLVSSEQALKELGLAEHQLRFTCRVHLHDTRKEQETALRVYSHLKSVLKDHCVQHLPDGSVTVESVLLQAAAPSEDPGTKVLLVSWTYQDEELGSFLTSLLKKGLPQAPS
- Uniprot:
- Q5TA45
- Synonyme:
- cleavage and polyadenylation specific factor 3-like;cleavage and polyadenylation-specific factor 3-like protein;CPSF3-like protein;CPSF3L;CPSF73L;INT11;integrator complex subunit 11;protein related to CPSF subunits of 68 kDa;RC-68;RC68;related to CPSF subunits 68 kDa
- Weitere Details:
- The Integrator complex contains at least 12 subunits and associates with the C-terminal domain of RNA polymerase II large subunit (POLR2A; MIM 180660) and mediates the 3-prime end processing of small nuclear RNAs U1 (RNU1; MIM 180680) and U2 (RNU2; MIM 180690). INTS11, or CPSF3L, is the catalytic subunit of the Integrator complex (Baillat et al., 2005 [PubMed 16239144]).
- Versandbedingungen:
- Blue Ice

