A22024
AMPKG Gamma1 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A22024
- Zusätzliche Namen:
- AMPKG|AMPKG Gamma1
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 37kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- KSALVQIYELEEHKIETWREVYLQDSFKPLVCISPNASLFDAVSSLIRNKIHRLPVIDPESGNTLYILTHKRILKFLKLFITEFPKPEFMSKSLEELQIGT
- Uniprot:
- P54619
- Synonyme:
- 5'-AMP-activated protein kinase subunit gamma-1;5'-AMP-activated protein kinase, gamma-1 subunit;AMPK gamma-1 chain;AMPK gamma1;AMPKG;protein kinase, AMP-activated, gamma 1 non-catalytic subunit
- Weitere Details:
- The protein encoded by this gene is a regulatory subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. AMPK is an important energy-sensing enzyme that monitors cellular energy status. In response to cellular metabolic stresses, AMPK is activated, and thus phosphorylates and inactivates acetyl-CoA carboxylase (ACC) and beta-hydroxy beta-methylglutaryl-CoA reductase (HMGCR), key enzymes involved in regulating de novo biosynthesis of fatty acid and cholesterol. This subunit is one of the gamma regulatory subunits of AMPK. Alternatively spliced transcript variants encoding distinct isoforms have been observed.
- Versandbedingungen:
- Blue Ice