HSPA4 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A22022
Zusätzliche Namen:: APG-2|HEL-S-5a|HS24/P52|hsp70|hsp70RY|HSPA4|HSPH2|RY
Anwendung:: ELISA, WB
Molekulargewicht:: 110kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: NLGQPIKIRFQESEERPKLFEELGKQIQQYMKIISSFKNKEDQYDHLDAADMTKVEKSTNEAMEWMNNKLNLQNKQSLTMDPVVKSKEIEAKIKELTSTCSPIISKPKPKVEPPKEEQKNAEQNGPVDGQGDNPGPQAAEQGTDTAVPSDSDKKLPEMDID
Uniprot:: P34932
Synonyme:: APG-2;epididymis secretory sperm binding protein Li 5a;heat shock 70 kDa protein 4;heat shock 70-related protein APG-2;heat shock 70kD protein 4;heat shock protein, 110 kDa;HEL-S-5a;HS24/P52;hsp70;hsp70 RY;hsp70RY;HSPH2;RY
Weitere Details:: Predicted to enable ATP binding activity. Involved in chaperone-mediated protein complex assembly and protein insertion into mitochondrial outer membrane. Located in cytosol and extracellular exosome. Implicated in Chagas disease. Biomarker of chronic obstructive pulmonary disease; rheumatoid arthritis; type 2 diabetes mellitus; and ulcerative colitis.