NDUFAB1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A22019
Zusätzliche Namen:: ACP|ACP1|FASN2A|NDUFAB1|SDAP
Anwendung:: ELISA, WB
Molekulargewicht:: 11kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: PALVLAQVPGRVTQLCRQYSDMPPLTLEGIQDRVLYVLKLYDKIDPEKLSVNSHFMKDLGLDSLDQVEIIMAMEDEFGFEIPDIDAEKLMCPQEIVDYIADKKDVYE
Uniprot:: O14561
Synonyme:: ACP;ACP1;acyl carrier protein, mitochondrial;CI-SDAP;complex I SDAP subunit;FASN2A;mitochondrial acyl carrier protein;NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1, 8kDa;NADH-ubiquinone oxidoreductase 9.6 kDa subunit;NADH:ubiquinone oxidoreductase SDAP subunit;SDAP
Weitere Details:: Predicted to enable acyl binding activity; acyl carrier activity; and fatty acid binding activity. Involved in mitochondrial respiratory chain complex I assembly and protein lipoylation. Located in mitochondrion and nucleoplasm. Part of mitochondrial respiratory chain complex I. Colocalizes with mitochondrial large ribosomal subunit.