[KD Validated] MIF Rabbit polyclonal antibody

Größe

Auf Anfrage

SKU:: A22014
Zusätzliche Namen:: GIF|GLIF|IF|MMIF
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 12kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: PMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
Uniprot:: P14174
Synonyme:: epididymis secretory sperm binding protein;GIF;GLIF;Glycosylation-inhibiting factor;L-dopachrome isomerase;L-dopachrome tautomerase;macrophage migration inhibitory factor;macrophage migration inhibitory factor (glycosylation-inhibiting factor);MMIF;phenylpyruvate tautomerase
Weitere Details:: This gene encodes a lymphokine involved in cell-mediated immunity, immunoregulation, and inflammation. It plays a role in the regulation of macrophage function in host defense through the suppression of anti-inflammatory effects of glucocorticoids. This lymphokine and the JAB1 protein form a complex in the cytosol near the peripheral plasma membrane, which may indicate an additional role in integrin signaling pathways.