A22013
PDLIM5 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A22013
- Zusätzliche Namen:
- ENH|ENH1|L9|LIM|PDLIM5
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 64kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- ADNTKKANNSQEPSPQLASSVASTRSMPESLDSPTSGRPGVTSLTAAAAFKPVGSTGVIKSPSWQRPNQGVPSTGRISNSATYSGSVAPANSALGQTQPSD
- Uniprot:
- Q96HC4
- Synonyme:
- ENH;ENH1;enigma homolog;enigma-like LIM domain protein;enigma-like PDZ and LIM domains protein;L9;LIM;PDZ and LIM domain protein 5
- Weitere Details:
- This gene encodes a member of a family of proteins that possess a 100-amino acid PDZ domain at the N terminus and one to three LIM domains at the C-terminus. This family member functions as a scaffold protein that tethers protein kinases to the Z-disk in striated muscles. It is thought to function in cardiomyocyte expansion and in restraining postsynaptic growth of excitatory synapses. Alternative splicing of this gene results in multiple transcript variants.
- Versandbedingungen:
- Blue Ice