[KD Validated]PHOX2B Rabbit polyclonal antibody

Größe

£152.00

SKU:: A21990
Zusätzliche Namen:: CCHS|NBLST2|NBPhox|PHOX2B|PMX2B
Anwendung:: ELISA, WB
Molekulargewicht:: 37kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: AGGLAAAGGPGQGWAPGPGPITSIPDSLGGPFASVLSSLQRPNGAKAALVKSSMF
Uniprot:: Q99453
Synonyme:: CCHS;NBLST2;NBPhox;neuroblastoma paired-type homeobox protein;neuroblastoma Phox;paired like homeobox2B;paired mesoderm homeobox 2b;paired mesoderm homeobox protein 2B;Paired-like homeobox 2B;PHOX2B homeodomain protein;PMX2B
Weitere Details:: The DNA-associated protein encoded by this gene is a member of the paired family of homeobox proteins localized to the nucleus. The protein functions as a transcription factor involved in the development of several major noradrenergic neuron populations and the determination of neurotransmitter phenotype. The gene product is linked to enhancement of second messenger-mediated activation of the dopamine beta-hydroylase, c-fos promoters and several enhancers, including cyclic amp-response element and serum-response element. Expansion of a 20 amino acid polyalanine tract in this protein by 5-13 aa has been associated with congenital central hypoventilation syndrome.