[KD Validated] FOSL1 Rabbit polyclonal antibody

Größe

Auf Anfrage

SKU:: A21988
Zusätzliche Namen:: [KD Validated] FOSL1|FRA|fra-1|FRA1
Anwendung:: ELISA, WB
Molekulargewicht:: 40kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MFRDFGEPGPSSGNGGGYGGPAQPPAAAQAAQQKFHLVPSINTMSGSQELQWMVQPHFLGPSSYPRPLTYPQYSPPQPRPGVIRALGPPPGVRRRPCEQI
Uniprot:: P15407
Synonyme:: FOS like 1, AP-1 trancription factor subunit;FOS-like antigen-1;fos-related antigen 1;FRA;fra-1;FRA1
Weitere Details:: The Fos gene family consists of 4 members: FOS, FOSB, FOSL1, and FOSL2. These genes encode leucine zipper proteins that can dimerize with proteins of the JUN family, thereby forming the transcription factor complex AP-1. As such, the FOS proteins have been implicated as regulators of cell proliferation, differentiation, and transformation. Several transcript variants encoding different isoforms have been found for this gene.