TLK1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A21987
Zusätzliche Namen:: PKU-beta|TLK1
Anwendung:: ELISA, WB
Molekulargewicht:: 87kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: FEYQGGNGSSPVRGIPPAIRSPQNSHSHSTPSSSVRPNSPSPTALAFGDHPIVQPKQLSFKIIQTDLTMLKLAALESNKIQDLEKKEGRIDDLLRANCDLR
Uniprot:: Q9UKI8
Synonyme:: PKU-beta;serine threonine protein kinase;serine/threonine-protein kinase tousled-like 1;SNARE protein kinase SNAK;Tousled-like kinase 1
Weitere Details:: The protein encoded by this gene is a serine/threonine kinase that may be involved in the regulation of chromatin assembly. The encoded protein is only active when it is phosphorylated, and this phosphorylation is cell cycle-dependent, with the maximal activity of this protein coming during S phase. The catalytic activity of this protein is diminished by DNA damage and by blockage of DNA replication. Three transcript variants encoding different isoforms have been found for this gene.