GPR109A/HM74A/HCAR2 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A21974
Zusätzliche Namen:: GPR109A|GPR109A/HM74A/HCAR2|HCA2|HM74a|HM74b|NIACR1|Puma-g|PUMAG
Anwendung:: ELISA, WB
Molekulargewicht:: 42kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: CRLMLFMLAMNRQGSIIFLTVVAVDRYFRVVHPHHALNKISNRTAAIISCLLWGITIGLTVHLLKKKMPIQNGGANLCSSFSICHTFQWHEAMFLLEFFLP
Uniprot:: Q8TDS4
Synonyme:: G protein-coupled receptor HM74a;G-protein coupled receptor 109A;G-protein coupled receptor HM74A;GPR109A;HCA2;HM74a;HM74b;hydroxy-carboxylic acid receptor 2;hydroxycarboxylic acid receptor 2;niacin receptor 1;NIACR1;nicotinic acid receptor;Puma-g;PUMAG
Weitere Details:: Predicted to enable nicotinic acid receptor activity. Involved in neutrophil apoptotic process and positive regulation of neutrophil apoptotic process. Located in cell junction and plasma membrane.