Sorbitol Dehydrogenase Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A21952
Zusätzliche Namen:: HEL-S-95n|RDH|SDH|Sorbitol Dehydrogenase|SORD1|SORDD|XDH
Anwendung:: ELISA, WB
Molekulargewicht:: 38kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: RENDEFCKMGRYNLSPSIFFCATPPDDGNLCRFYKHNAAFCYKLPDNVTFEEGALIEPLSVGIHACRRGGVTLGHKVLVCGAGPIGMVTLLVAKAMGAAQV
Uniprot:: Q00796
Synonyme:: (R,R)-butanediol dehydrogenase;epididymis secretory sperm binding protein Li 95n;HEL-S-95n;L-iditol 2-dehydrogenase;polyol dehydrogenase;RDH;ribitol dehydrogenase;SDH;sorbitol dehydrogenase;SORD1;SORDD;XDH;xylitol dehydrogenase
Weitere Details:: Sorbitol dehydrogenase (SORD; EC 1.1.1.14) catalyzes the interconversion of polyols and their corresponding ketoses, and together with aldose reductase (ALDR1; MIM 103880), makes up the sorbitol pathway that is believed to play an important role in the development of diabetic complications (summarized by Carr and Markham, 1995 [PubMed 8535074]). The first reaction of the pathway (also called the polyol pathway) is the reduction of glucose to sorbitol by ALDR1 with NADPH as the cofactor. SORD then oxidizes the sorbitol to fructose using NAD(+) cofactor.