S100A11 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A21929
Zusätzliche Namen:: HEL-S-43|MLN70|S100A11|S100C
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 12kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MAKISSPTETERCIESLIAVFQKYAGKDGYNYTLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDTNSDGQLDFSEFLNLIGGLAMACHDSFLKAVPSQKRT
Uniprot:: P31949
Synonyme:: calgizzarin;epididymis secretory protein Li 43;HEL-S-43;metastatic lymph node gene 70 protein;MLN 70;MLN70;protein S100-A11;protein S100-C;S100 calcium-binding protein A11;S100C
Weitere Details:: The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in motility, invasion, and tubulin polymerization. Chromosomal rearrangements and altered expression of this gene have been implicated in tumor metastasis.