[KD Validated] Aurora B Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A21918
Zusätzliche Namen:: [KD Validated] Aurora B|AIK2|AIM-1|AIM1|ARK-2|ARK2|AurB|aurkb-sv1|aurkb-sv2|IPL1|PPP1R48|STK-1|STK12|STK5
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 39kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MAQKENSYPWPYGRQTAPSGLSTLPQRVLRKEPVTPSALVLMSRSNVQPTAAPGQKVMENSSGTPDILTRHFTIDDFEIGRPLGKGKFGNVYLAREKKSH
Uniprot:: Q96GD4
Synonyme:: AIK2;AIM-1;AIM1;ARK-2;ARK2;AurB;aurkb-sv1;aurkb-sv2;Aurora 1;aurora kinase B;aurora kinase B-Sv1;aurora kinase B-Sv2;aurora- and Ipl1-like midbody-associated protein 1;aurora-1;aurora-B;aurora-related kinase 2;aurora/IPL1-related kinase 2;IPL1;PPP1R48;protein phosphatase 1, regulatory subunit 48;serine/threonine kinase 12;serine/threonine-protein kinase 12;serine/threonine-protein kinase 5;serine/threonine-protein kinase aurora-B;STK-1;STK12;STK5
Weitere Details:: This gene encodes a member of the aurora kinase subfamily of serine/threonine kinases. The genes encoding the other two members of this subfamily are located on chromosomes 19 and 20. These kinases participate in the regulation of alignment and segregation of chromosomes during mitosis and meiosis through association with microtubules. A pseudogene of this gene is located on chromosome 8. Alternatively spliced transcript variants have been found for this gene.

Versandbedingungen:: Blue Ice