[KD Validated] JNK1 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A21888
Zusätzliche Namen:: [KD Validated] JNK1|JNK
Anwendung:: ELISA, WB, IP
Molekulargewicht:: 44kDa/48kd
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: KKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSKMLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTIE
Uniprot:: P45983
Synonyme:: c-Jun N-terminal kinase 1;JNK;JNK-46;JNK1;JNK1A2;JNK21B1/2;JUN N-terminal kinase;MAP kinase 8;mitogen-activated protein kinase 8;PRKM8;SAPK1;SAPK1c;stress-activated protein kinase 1;stress-activated protein kinase 1c;Stress-activated protein kinase JNK1
Weitere Details:: The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. This kinase is activated by various cell stimuli, and targets specific transcription factors, and thus mediates immediate-early gene expression in response to cell stimuli. The activation of this kinase by tumor-necrosis factor alpha (TNF-alpha) is found to be required for TNF-alpha induced apoptosis. This kinase is also involved in UV radiation induced apoptosis, which is thought to be related to cytochrom c-mediated cell death pathway. Studies of the mouse counterpart of this gene suggested that this kinase play a key role in T cell proliferation, apoptosis and differentiation. Several alternatively spliced transcript variants encoding distinct isoforms have been reported.

Versandbedingungen:: Blue Ice