A2188
PSMA6 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A2188
- Zusätzliche Namen:
- IOTA|p27K|PROS27|PSMA6
- Anwendung:
- ELISA, WB, IF, ICC
- Molekulargewicht:
- 27kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLVALAERD
- Uniprot:
- P60900
- Synonyme:
- 27 kDa prosomal protein;IOTA;macropain iota chain;macropain subunit iota;multicatalytic endopeptidase complex iota chain;p27K;PROS-27;PROS27;prosomal P27K protein;proteasome (prosome, macropain) subunit, alpha type, 6;proteasome iota chain;proteasome subunit alpha 6;proteasome subunit alpha type-6;proteasome subunit alpha1;proteasome subunit iota;testicular secretory protein Li 44
- Weitere Details:
- The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit. Multiple transcript variants encoding several different isoforms have been found for this gene. A pseudogene has been identified on the Y chromosome.
- Versandbedingungen:
- Blue Ice



