MST1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A21842
Zusätzliche Namen:: KRS2|MST1|STK4|YSK3
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 56kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: KRQESQQREVDQDDEENSEEDEMDSGTMVRAVGDEMGTVRVASTMTDGANTMIEHDDTLPSQLGTMVINAEDEEEEGTMKRRDETMQPAKPSFLEYFEQKEKENQINSFGKSVPGPLKNSSDWKIPQDGDYEFLKSWTVEDLQKRLLALDPMMEQEIEEIRQKYQSKRQPILDAIEAKKRRQQNF
Uniprot:: Q13043
Synonyme:: hippo homolog;kinase responsive to stress 2;KRS2;mammalian STE20-like protein kinase 1;mammalian sterile 20-like 1;MST1;serine/threonine-protein kinase 4;serine/threonine-protein kinase Krs-2;STE20-like kinase MST1;YSK3
Weitere Details:: The protein encoded by this gene is a cytoplasmic kinase that is structurally similar to the yeast Ste20p kinase, which acts upstream of the stress-induced mitogen-activated protein kinase cascade. The encoded protein can phosphorylate myelin basic protein and undergoes autophosphorylation. A caspase-cleaved fragment of the encoded protein has been shown to be capable of phosphorylating histone H2B. The particular phosphorylation catalyzed by this protein has been correlated with apoptosis, and it's possible that this protein induces the chromatin condensation observed in this process.

Versandbedingungen:: Blue Ice