A2183
PMS1 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A2183
- Zusätzliche Namen:
- HNPCC3|hPMS1|MLH2|PMS1|PMSL1
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 110kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- DCLNHQISIGDFGYGHCSSEISNIDKNTKNAFQDISMSNVSWENSQTEYSKTCFISSVKHTQSENGNKDHIDESGENEEEAGLENSSEISADEWSRGNILKNSVGENIEPVKILVPEKSLPCKVSNNNYPIPEQMNLNEDSCNKKSNVIDNKSGKVTAYDLLSNRVIKKPMSASALFVQDHRPQFLIENPKTSLEDATLQIEELWKTLSEEEKLK
- Uniprot:
- P54277
- Synonyme:
- DNA mismatch repair protein PMS1;HNPCC3;hPMS1;human homolog of yeast mutL;mismatch repair gene PMSL1;MLH2;PMS1 postmeiotic segregation increased 1;PMS1 protein homolog 1;PMSL1;rhabdomyosarcoma antigen MU-RMS-40.10B;rhabdomyosarcoma antigen MU-RMS-40.10E
- Weitere Details:
- This gene encodes a protein belonging to the DNA mismatch repair mutL/hexB family. This protein is thought to be involved in the repair of DNA mismatches, and it can form heterodimers with MLH1, a known DNA mismatch repair protein. Mutations in this gene cause hereditary nonpolyposis colorectal cancer type 3 (HNPCC3) either alone or in combination with mutations in other genes involved in the HNPCC phenotype, which is also known as Lynch syndrome.
- Versandbedingungen:
- Blue Ice

