PMS1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A2183
Zusätzliche Namen:: HNPCC3|hPMS1|MLH2|PMS1|PMSL1
Anwendung:: ELISA, WB
Molekulargewicht:: 110kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: DCLNHQISIGDFGYGHCSSEISNIDKNTKNAFQDISMSNVSWENSQTEYSKTCFISSVKHTQSENGNKDHIDESGENEEEAGLENSSEISADEWSRGNILKNSVGENIEPVKILVPEKSLPCKVSNNNYPIPEQMNLNEDSCNKKSNVIDNKSGKVTAYDLLSNRVIKKPMSASALFVQDHRPQFLIENPKTSLEDATLQIEELWKTLSEEEKLK
Uniprot:: P54277
Synonyme:: DNA mismatch repair protein PMS1;HNPCC3;hPMS1;human homolog of yeast mutL;mismatch repair gene PMSL1;MLH2;PMS1 postmeiotic segregation increased 1;PMS1 protein homolog 1;PMSL1;rhabdomyosarcoma antigen MU-RMS-40.10B;rhabdomyosarcoma antigen MU-RMS-40.10E
Weitere Details:: This gene encodes a protein belonging to the DNA mismatch repair mutL/hexB family. This protein is thought to be involved in the repair of DNA mismatches, and it can form heterodimers with MLH1, a known DNA mismatch repair protein. Mutations in this gene cause hereditary nonpolyposis colorectal cancer type 3 (HNPCC3) either alone or in combination with mutations in other genes involved in the HNPCC phenotype, which is also known as Lynch syndrome.