PLC gamma 2 (PLCG2) Rabbit polyclonal antibody

Größe

£152.00

SKU:: A2182
Zusätzliche Namen:: APLAID|FCAS3|PLC gamma 2 (PLCG2)|PLC-gamma-2|PLC-IV
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 175kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MSTTVNVDSLAEYEKSQIKRALELGTVMTVFSFRKSTPERRTVQVIMETRQVAWSKTADKIEGFLDIMEIKEIRPGKNSKDFERAKAVRQKEDCCFTILYGTQFVLSTLSLAADSKEDAVNWLSGLKILHQEAMNASTPTIIESWLRKQIYSVDQTRRNSISLRELKTILPLINFKVSSAKFLKDKFVEIGAHKDELSFEQFHLFYKKLMFEQQKSILDEFKKDSSVFILGNTDRPDASAVYLHDFQRFLIHEQQEHWAQDLNKVRERMTKFIDDTMRETAEPFLFVDEFLTYLFSRENS
Uniprot:: P16885
Synonyme:: 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2;APLAID;FCAS3;phosphoinositide phospholipase C-gamma-2;Phospholipase C-gamma-2;phospholipase C-IV;phospholipase C, gamma 2 (phosphatidylinositol-specific);PLC-gamma-2;PLC-IV
Weitere Details:: The protein encoded by this gene is a transmembrane signaling enzyme that catalyzes the conversion of 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate to 1D-myo-inositol 1,4,5-trisphosphate (IP3) and diacylglycerol (DAG) using calcium as a cofactor. IP3 and DAG are second messenger molecules important for transmitting signals from growth factor receptors and immune system receptors across the cell membrane. Mutations in this gene have been found in autoinflammation, antibody deficiency, and immune dysregulation syndrome and familial cold autoinflammatory syndrome 3.

Versandbedingungen:: Blue Ice