Peroxiredoxin 2 (PRDX2) Rabbit polyclonal antibody

Größe

Auf Anfrage

SKU:: A21814
Zusätzliche Namen:: HEL-S-2a|NKEF-B|NKEFB|Peroxiredoxin 2 (PRDX2)|PRP|PRX2|PRXII|PTX1|TDPX1|TPX1|TSA
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: Refer to figures
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MASGNARIGKPAPDFKATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSNRAEDFRKLGCEVLGVSVDSQFTHLAWYEQGPKREVAAKLTPSGPSSVASWPLLNLWNLRFPIVKIMETLPPKSLRMMTVISI
Uniprot:: P32119
Synonyme:: epididymis secretory sperm binding protein Li 2a;HEL-S-2a;natural killer cell-enhancing factor B;NKEF-B;NKEFB;peroxiredoxin-2;PRP;PRX2;PRXII;PTX1;TDPX1;thiol-specific antioxidant 1;Thiol-specific antioxidant protein;thioredoxin peroxidase 1;thioredoxin-dependent peroxide reductase 1;thioredoxin-dependent peroxiredoxin 2;torin;TPX1;TSA
Weitere Details:: This gene encodes a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. The encoded protein plays an antioxidant protective role in cells, and it may contribute to the antiviral activity of CD8(+) T-cells. The crystal structure of this protein has been resolved to 2.7 angstroms. This protein prevents hemolytic anemia from oxidative stress by stabilizing hemoglobin, thus making this gene a therapeutic target for patients with hemolytic anemia. This protein may have a proliferative effect and play a role in cancer development or progression. Related pseudogenes have been identified on chromosomes 5, 6, 10 and 13.

Versandbedingungen:: Blue Ice