A21798
RhoC Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A21798
- Zusätzliche Namen:
- ARH9|ARHC|H9|RhoC|RHOH9
- Anwendung:
- ELISA, WB, IF, ICC
- Molekulargewicht:
- 22kDa/21kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- NIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVRSEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAGLQVRKNKRRRGCPIL
- Uniprot:
- P08134
- Synonyme:
- ARH9;ARHC;epididymis secretory sperm binding protein;H9;oncogene RHO H9;ras homolog gene family, member C;RAS-related homolog 9;rho cDNA clone 9;rho-related GTP-binding protein RhoC;rhoC GTPase;RHOH9;small GTP binding protein RhoC
- Weitere Details:
- This gene encodes a member of the Rho family of small GTPases, which cycle between inactive GDP-bound and active GTP-bound states and function as molecular switches in signal transduction cascades. Rho proteins promote reorganization of the actin cytoskeleton and regulate cell shape, attachment, and motility. The protein encoded by this gene is prenylated at its C-terminus, and localizes to the cytoplasm and plasma membrane. It is thought to be important in cell locomotion. Overexpression of this gene is associated with tumor cell proliferation and metastasis. Multiple alternatively spliced variants, encoding the same protein, have been identified.
- Versandbedingungen:
- Blue Ice