A21756
Raptor Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A21756
- Zusätzliche Namen:
- KOG1|Mip1|Raptor
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 150kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- LTNDVAKQPVSRDLPSGRPGTTGPAGAQYTPHSHQFPRTRKMFDKGPEQTADDADDAAGHKSFISATVQTGFCDWSARYFAQPVMKIPEEHDLESQIRKEREWRFLRNSRVRRQAQQVIQKGITRL
- Uniprot:
- Q8N122
- Synonyme:
- KOG1;Mip1;p150 target of rapamycin (TOR)-scaffold protein;p150 target of rapamycin (TOR)-scaffold protein containing WD-repeats;raptor;regulatory-associated protein of mTOR
- Weitere Details:
- This gene encodes a component of a signaling pathway that regulates cell growth in response to nutrient and insulin levels. The encoded protein forms a stoichiometric complex with the mTOR kinase, and also associates with eukaryotic initiation factor 4E-binding protein-1 and ribosomal protein S6 kinase. The protein positively regulates the downstream effector ribosomal protein S6 kinase, and negatively regulates the mTOR kinase. Multiple transcript variants encoding different isoforms have been found for this gene.
- Versandbedingungen:
- Blue Ice

