A21753
MCU Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A21753
- Zusätzliche Namen:
- C10orf42|CCDC109A|HsMCU|MCU
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 35kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- VHQRIASWQNLGAVYCSTVVPSDDVTVVYQNGLPVISVRLPSRRERCQFTLKPISDSVGVFLRQLQEEDRGIDRVAIYSPDGVRVAASTGIDLLLLDDFKLVINDLTYHVRPPKRDLLSH
- Uniprot:
- Q8NE86
- Synonyme:
- C10orf42;calcium uniporter protein, mitochondrial;CCDC109A;coiled-coil domain-containing protein 109A;HsMCU
- Weitere Details:
- Enables calcium channel activity; identical protein binding activity; and uniporter activity. Involved in several processes, including positive regulation of mitochondrial calcium ion concentration; positive regulation of mitochondrial fission; and positive regulation of neutrophil chemotaxis. Acts upstream of or within calcium import into the mitochondrion. Located in mitochondrial inner membrane. Is integral component of mitochondrial inner membrane. Part of uniplex complex.
- Versandbedingungen:
- Blue Ice

