A21752
ACC1 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A21752
- Zusätzliche Namen:
- ACAC|Acac1|ACACAD|ACACalpha|ACC|ACC1|ACCA|ACCalpha|hACC1
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 265kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- NRGNIPTLNRMSFSSNLNHYGMTHVASVSDVLLDNSFTPPCQRMGGMVSFRTFEDFVRIFDEVMGCFSDSPPQSPTFPEAGHTSLYDEDKVPRDEPIHILNVAIKTDCDIEDDRLAAMFREFTQQNKATLVDHGIRRLTFLVAQKDFRKQV
- Uniprot:
- Q13085
- Synonyme:
- ACAC;ACACAD;ACC;ACC-alpha;ACC1;ACCA;acetyl-CoA carboxylase 1;acetyl-Coenzyme A carboxylase alpha
- Weitere Details:
- Acetyl-CoA carboxylase (ACC) is a complex multifunctional enzyme system. ACC is a biotin-containing enzyme which catalyzes the carboxylation of acetyl-CoA to malonyl-CoA, the rate-limiting step in fatty acid synthesis. There are two ACC forms, alpha and beta, encoded by two different genes. ACC-alpha is highly enriched in lipogenic tissues. The enzyme is under long term control at the transcriptional and translational levels and under short term regulation by the phosphorylation/dephosphorylation of targeted serine residues and by allosteric transformation by citrate or palmitoyl-CoA. Multiple alternatively spliced transcript variants divergent in the 5' sequence and encoding distinct isoforms have been found for this gene.
- Versandbedingungen:
- Blue Ice



