A21690
ATG4D Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A21690
- Zusätzliche Namen:
- APG4-D|APG4D|ATG4D|AUTL4|HsAPG4D
- Anwendung:
- ELISA, WB, IF, ICC
- Molekulargewicht:
- Refer to figures
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MNSVSPAAAQYRSSSPEDARRRPEARRPRGPRGPDPNGLGPSGASGPALGSPGAGPSEPDEVDKFKAKFLTAWNNVKYGWVVKSRTSFSKISSIHLCGRRYRFEGEGDIQRFQRDFVSRLWLTYRRDFPPLPGGCLTSDCGWGCMLRSGQMMLAQGLLLHFLPRDWTWAEGMGLGPPELSGSASPSRYHGPARWMPPRWAQGAPELEQERRHRQIVSWFADHPRAPFGLH
- Uniprot:
- Q86TL0
- Synonyme:
- APG4 autophagy 4 homolog D;APG4-D;APG4D;ATG4 autophagy related 4 homolog D;AUT-like 4 cysteine endopeptidase;AUTL4;autophagin-4;autophagy-related cysteine endopeptidase 4;autophagy-related protein 4 homolog D;cysteine protease ATG4D;cysteine protease involved in autophagy
- Weitere Details:
- Autophagy is the process by which endogenous proteins and damaged organelles are destroyed intracellularly. Autophagy is postulated to be essential for cell homeostasis and cell remodeling during differentiation, metamorphosis, non-apoptotic cell death, and aging. Reduced levels of autophagy have been described in some malignant tumors, and a role for autophagy in controlling the unregulated cell growth linked to cancer has been proposed. This gene belongs to the autophagy-related protein 4 (Atg4) family of C54 endopeptidases. Members of this family encode proteins that play a role in the biogenesis of autophagosomes, which sequester the cytosol and organelles for degradation by lysosomes. Alternative splicing results in multiple transcript variants.
- Versandbedingungen:
- Blue Ice