A2169
IDH1 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A2169
- Zusätzliche Namen:
- HEL-216|HEL-S-26|IDCD|IDH|IDH1|IDP|IDPC|PICD
- Anwendung:
- ELISA, WB, IF, ICC
- Molekulargewicht:
- 46kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- RNILGGTVFREAIICKNIPRLVSGWVKPIIIGRHAYGDQYRATDFVVPGPGKVEITYTPSDGTQKVTYLVHNFEEGGGVAMGMYNQDKSIEDFAHSSFQMA
- Uniprot:
- O75874
- Synonyme:
- Cytosolic NADP-isocitrate dehydrogenase;epididymis luminal protein 216;epididymis secretory protein Li 26;epididymis secretory sperm binding protein;HEL-216;HEL-S-26;IDCD;IDH;IDP;IDPC;isocitrate dehydrogenase (NADP(+)) 1, cytosolic;isocitrate dehydrogenase [NADP] cytoplasmic;isocitrate dehydrogenase 1 (NADP+), soluble;NADP-dependent isocitrate dehydrogenase, cytosolic;NADP-dependent isocitrate dehydrogenase, peroxisomal;NADP(+)-specific ICDH;oxalosuccinate decarboxylase;PICD
- Weitere Details:
- Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. Each NADP(+)-dependent isozyme is a homodimer. The protein encoded by this gene is the NADP(+)-dependent isocitrate dehydrogenase found in the cytoplasm and peroxisomes. It contains the PTS-1 peroxisomal targeting signal sequence. The presence of this enzyme in peroxisomes suggests roles in the regeneration of NADPH for intraperoxisomal reductions, such as the conversion of 2, 4-dienoyl-CoAs to 3-enoyl-CoAs, as well as in peroxisomal reactions that consume 2-oxoglutarate, namely the alpha-hydroxylation of phytanic acid. The cytoplasmic enzyme serves a significant role in cytoplasmic NADPH production. Alternatively spliced transcript variants encoding the same protein have been found for this gene.
- Versandbedingungen:
- Blue Ice