USP4 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A21644
Zusätzliche Namen:: UNP|Unph|USP4
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 108kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: DDIFVYEVCSTSVDGSECVTLPVYFRERKSRPSSTSSASALYGQPLLLSVPKHKLTLESLYQAVCDRISRYVKQPLPDEFGSSPLEPGACNGSRNSCEGEDEEEMEHQEEGKEQLSETEGSGEDEPGNDPSETTQKKIKGQ
Uniprot:: Q13107
Synonyme:: deubiquitinating enzyme 4;ubiquitin carboxyl-terminal esterase 4;ubiquitin carboxyl-terminal hydrolase 4;ubiquitin specific peptidase 4 (proto-oncogene);ubiquitin specific protease 4 (proto-oncogene);ubiquitin thioesterase 4;ubiquitin thiolesterase 4;ubiquitin-specific processing protease 4;Ubiquitin-specific-processing protease 4;ubiquitous nuclear protein homolog;UNP;Unph
Weitere Details:: The protein encoded by this gene is a protease that deubiquitinates target proteins such as ADORA2A and TRIM21. The encoded protein shuttles between the nucleus and cytoplasm and is involved in maintaining operational fidelity in the endoplasmic reticulum. Three transcript variants encoding different isoforms have been found for this gene.