A21643
[KO Validated] SUMO1 Rabbit polyclonal antibody

Größe
Auf Anfrage
- SKU:
- A21643
- Zusätzliche Namen:
- DAP1|GMP1|O1|OFC10|PIC1|SENP2|SMT3|SMT3C|SMT3H3|UBL1
- Anwendung:
- ELISA, WB, IHC-P, IF, ICC
- Molekulargewicht:
- 16kDa/80kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHST
- Uniprot:
- P63165
- Synonyme:
- DAP1;GAP modifying protein 1;GAP-modifying protein 1;GMP1;OFC10;PIC1;SENP2;sentrin;small ubiquitin-related modifier 1;SMT3;SMT3 homolog 3;SMT3 suppressor of mif two 3 homolog 1;SMT3C;SMT3H3;ubiquitin-homology domain protein PIC1;ubiquitin-like protein SMT3C;ubiquitin-like protein UBL1;UBL1
- Weitere Details:
- This gene encodes a protein that is a member of the SUMO (small ubiquitin-like modifier) protein family. It functions in a manner similar to ubiquitin in that it is bound to target proteins as part of a post-translational modification system. However, unlike ubiquitin which targets proteins for degradation, this protein is involved in a variety of cellular processes, such as nuclear transport, transcriptional regulation, apoptosis, and protein stability. It is not active until the last four amino acids of the carboxy-terminus have been cleaved off. Several pseudogenes have been reported for this gene. Alternate transcriptional splice variants encoding different isoforms have been characterized.
- Versandbedingungen:
- Blue Ice
![[KO Validated] SUMO1 Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A21643/A21643_1.jpg)
![[KO Validated] SUMO1 Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A21643/A21643_2.jpg)
![[KO Validated] SUMO1 Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A21643/A21643_3.jpg)
![[KO Validated] SUMO1 Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A21643/A21643_4.jpg)
![[KO Validated] SUMO1 Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A21643/A21643_5.jpg)
![[KO Validated] SUMO1 Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A21643/A21643_N1809-5_KO-WB_01.jpg)
![[KO Validated] SUMO1 Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A21643/A21643_N1811-5_IHC_02.jpg)
![[KO Validated] SUMO1 Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A21643/A21643_N1811-5_IHC_04.jpg)
![[KO Validated] SUMO1 Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A21643/A21643_N1811-5_IHC_05.jpg)