p53 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A21630
Zusätzliche Namen:: bbl|bfy|bhy|p44|p53|Tp53
Anwendung:: ELISA, WB, IHC-P, IF, ICC, IP
Molekulargewicht:: Refer to figures
Spezies-Reaktivität:: Mouse
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: EVLCPELPPGSAKRALPTCTSASPPQKKKPLDGEYFTLKIRGRKRFEMFRELNEALELKDAHATEESGDSRAHSSYLKTKKGQSTSRHKKTMVKKVGPDSD
Uniprot:: P02340
Synonyme:: antigen NY-CO-13;bbl;BCC7;bfy;bhy;BMFS5;cellular tumor antigen p53;LFS1;ME-delta123p53;mutant p53;mutant tumor protein 53;p4;p44;p5;P53;p53 cellular tumor antigen;p53 tumor suppressor;phosphoprotein p53;Tp53;transformation-related protein 53;TRP53;tumor protein 53;tumor suppressor p53;tumor supressor p53
Weitere Details:: This gene encodes tumor protein p53, which responds to diverse cellular stresses to regulate target genes that induce cell cycle arrest, apoptosis, senescence, DNA repair, or changes in metabolism. p53 protein is expressed at low level in normal cells and at a high level in a variety of transformed cell lines, where it's believed to contribute to transformation and malignancy. p53 is a DNA-binding protein containing transcription activation, DNA-binding, and oligomerization domains. It is postulated to bind to a p53-binding site and activate expression of downstream genes that inhibit growth and/or invasion, and thus function as a tumor suppressor. Mice deficient for this gene are developmentally normal but are susceptible to spontaneous tumors. Evidence to date shows that this gene contains one promoter, in contrast to alternative promoters of the human gene, and transcribes a few of splice variants which encode different isoforms, although the biological validity or the full-length nature of some variants has not been determined.

Versandbedingungen:: Blue Ice