A21569
[KO Validated] PBK Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A21569
- Zusätzliche Namen:
- CT84|HEL164|Nori-3|PBK|SPK|TOPK
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 36kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MEGISNFKTPSKLSEKKKSVLCSTPTINIPASPFMQKLGFGTGVNVYLMKRSPRGLSHSPWAVKKINPICNDHYRSVYQKRLMDEAKILKSLHHPNIVGYRAFTEANDGSLCLAMEYGGEKSLNDLIEERYKASQDPFPAAIILKVALNMARGLKYLHQEKKLLHGDIKSSNVVIKGDFETIKICDVGVSLPLDENMTVTDPEACYIGTEPWKPKEAVEENGVITDKADIFAFGLTLWEMMTLSIPHINLSNDDDDEDKTFDESDFDDEAYYAALGTRPPINMEELDESYQKVIELFSVCTNEDPKDRPSAAHIVEALETDV
- Uniprot:
- Q96KB5
- Synonyme:
- cancer/testis antigen 84;CT84;epididymis luminal protein 164;HEL164;lymphokine-activated killer T-cell-originated protein kinase;MAPKK-like protein kinase;Nori-3;PDZ-binding kinase;serine/threonine protein kinase;spermatogenesis-related protein kinase;SPK;T-LAK cell-originated protein kinase;TOPK
- Weitere Details:
- This gene encodes a serine/threonine protein kinase related to the dual specific mitogen-activated protein kinase kinase (MAPKK) family. Evidence suggests that mitotic phosphorylation is required for its catalytic activity. The encoded protein may be involved in the activation of lymphoid cells and support testicular functions, with a suggested role in the process of spermatogenesis. Overexpression of this gene has been implicated in tumorigenesis. Alternative splicing results in multiple transcript variants.
- Versandbedingungen:
- Blue Ice
![[KO Validated] PBK Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A21569/A21569_1.jpg)
![[KO Validated] PBK Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A21569/A21569_2.jpg)
![[KO Validated] PBK Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A21569/A21569_3.jpg)
![[KO Validated] PBK Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A21569/A21569_P5346(2)_WB_01.jpg)
![[KO Validated] PBK Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A21569/A21569_P5345(2)_WB_01.jpg)
![[KO Validated] PBK Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A21569/A21569_P5345(2)_WB_02.jpg)